Lineage for d1u7ke_ (1u7k E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330931Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2330932Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2330933Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2330934Protein AKV capsid [116949] (2 species)
  7. 2330935Species AKV murine leukemia virus [TaxId:11791] [116950] (1 PDB entry)
    Uniprot P03336 215-345 # fragment of the core shell protein p30 (215-477)
  8. 2330940Domain d1u7ke_: 1u7k E: [113091]

Details for d1u7ke_

PDB Entry: 1u7k (more details), 1.85 Å

PDB Description: Structure of a hexameric N-terminal domain from murine leukemia virus capsid
PDB Compounds: (E:) gag polyprotein

SCOPe Domain Sequences for d1u7ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7ke_ a.73.1.1 (E:) AKV capsid {AKV murine leukemia virus [TaxId: 11791]}
plrmggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllagmqnagr

SCOPe Domain Coordinates for d1u7ke_:

Click to download the PDB-style file with coordinates for d1u7ke_.
(The format of our PDB-style files is described here.)

Timeline for d1u7ke_: