SCOPe 2.07: Domain d1u7hb_: 1u7h B:

Lineage for d1u7hb_ (1u7h B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.13: Ornithine cyclodeaminase-like [110436] (2 proteins)
   Pfam PF02423; contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet

6. Protein Ornithine cyclodeaminase [117437] (1 species)

7. Species Pseudomonas putida [TaxId:303] [117438] (2 PDB entries)
   Uniprot Q88H32

8. Domain d1u7hb_: 1u7h B: [113086]
   complexed with mpd, na, nad

Details for d1u7hb_

PDB Entry: 1u7h, 1.8 Å

PDB Description: Structure and a Proposed Mechanism for Ornithine Cyclodeaminase from Pseudomonas putida

PDB Compounds: (B:) ornithine cyclodeaminase

SCOPe Domain Sequences for d1u7hb_:

Sequence; same for both SEQRES and ATOM records:

>d1u7hb_ c.2.1.13 (B:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]}
mtyfidvptmsdlvhdigvapfigelaaalrddfkrwqafdksarvashsevgvielmpv
adksryafkyvnghpantarnlhtvmafgvladvdsgypvllseltiatalrtaatslma
aqalarpnarkmaligngaqsefqalafhkhlgieeivaydtdplataklianlkeysgl
tirrassvaeavkgvdiittvtadkayatiitpdmlepgmhlnavggdcpgktelhadvl
rnarvfveyepqtriegeiqqlpadfpvvdlwrvlrgetegrqsdsqvtvfdsvgfaled
ytvlryvlqqaekrgmgtkidlvpwveddpkdlfshtrgr

Timeline for d1u7hb_:

• d1u7hb_ first appeared in SCOP 1.71
  
• d1u7hb_ appears in SCOPe 2.06
  
• d1u7hb_ appears in the current release, SCOPe 2.08