Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.13: Ornithine cyclodeaminase-like [110436] (2 proteins) Pfam PF02423; contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet |
Protein Ornithine cyclodeaminase [117437] (1 species) |
Species Pseudomonas putida [TaxId:303] [117438] (2 PDB entries) Uniprot Q88H32 |
Domain d1u7hb_: 1u7h B: [113086] complexed with mpd, na, nad |
PDB Entry: 1u7h (more details), 1.8 Å
SCOPe Domain Sequences for d1u7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7hb_ c.2.1.13 (B:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} mtyfidvptmsdlvhdigvapfigelaaalrddfkrwqafdksarvashsevgvielmpv adksryafkyvnghpantarnlhtvmafgvladvdsgypvllseltiatalrtaatslma aqalarpnarkmaligngaqsefqalafhkhlgieeivaydtdplataklianlkeysgl tirrassvaeavkgvdiittvtadkayatiitpdmlepgmhlnavggdcpgktelhadvl rnarvfveyepqtriegeiqqlpadfpvvdlwrvlrgetegrqsdsqvtvfdsvgfaled ytvlryvlqqaekrgmgtkidlvpwveddpkdlfshtrgr
Timeline for d1u7hb_: