Lineage for d1u7ba2 (1u7b A:127-255)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611115Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 611116Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 611157Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 611179Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 611218Species Human (Homo sapiens) [TaxId:9606] [55991] (3 PDB entries)
  8. 611220Domain d1u7ba2: 1u7b A:127-255 [113084]
    complexed with a target peptide

Details for d1u7ba2

PDB Entry: 1u7b (more details), 1.88 Å

PDB Description: Crystal structure of hPCNA bound to residues 331-350 of the flap endonuclease-1 (FEN1)

SCOP Domain Sequences for d1u7ba2:

Sequence, based on SEQRES records: (download)

>d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records): (download)

>d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
eeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyy
lapki

SCOP Domain Coordinates for d1u7ba2:

Click to download the PDB-style file with coordinates for d1u7ba2.
(The format of our PDB-style files is described here.)

Timeline for d1u7ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u7ba1