SCOPe 2.02: Domain d1u76e2: 1u76 E:127-255

Lineage for d1u76e2 (1u76 E:127-255)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
   Uniprot P12004

8. Domain d1u76e2: 1u76 E:127-255 [113082]
   complexed with a target peptide

Details for d1u76e2

PDB Entry: 1u76, 2.6 Å

PDB Description: Crystal structure of hPCNA bound to residues 452-466 of the DNA polymerase-delta-p66 subunit

PDB Compounds: (E:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1u76e2:

Sequence, based on SEQRES records:

>d1u76e2 d.131.1.2 (E:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records):

>d1u76e2 d.131.1.2 (E:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
eavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyyla
pki

Timeline for d1u76e2:

• d1u76e2 first appeared in SCOP 1.71
  
• d1u76e2 appears in SCOPe 2.01
  
• d1u76e2 appears in SCOPe 2.03
  
• d1u76e2 appears in the current release, SCOPe 2.08