| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries) Uniprot P12004 |
| Domain d1u76e1: 1u76 E:1-126 [113081] complexed with a target peptide |
PDB Entry: 1u76 (more details), 2.6 Å
SCOPe Domain Sequences for d1u76e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u76e1 d.131.1.2 (E:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql
Timeline for d1u76e1:
View in 3DDomains from other chains: (mouse over for more information) d1u76a1, d1u76a2, d1u76c1, d1u76c2 |