SCOP 1.71: Domain d1u76e1: 1u76 E:1-126

Lineage for d1u76e1 (1u76 E:1-126)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (3 PDB entries)

8. Domain d1u76e1: 1u76 E:1-126 [113081]

Details for d1u76e1

PDB Entry: 1u76, 2.6 Å

PDB Description: Crystal structure of hPCNA bound to residues 452-466 of the DNA polymerase-delta-p66 subunit

SCOP Domain Sequences for d1u76e1:

Sequence; same for both SEQRES and ATOM records:

>d1u76e1 d.131.1.2 (E:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Timeline for d1u76e1:

• d1u76e1 is new in SCOP 1.71
  
• d1u76e1 appears in SCOP 1.73
  
• d1u76e1 appears in the current release, SCOPe 2.08