Lineage for d1u76a2 (1u76 A:127-255)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583562Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2583631Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries)
    Uniprot P12004
  8. 2583661Domain d1u76a2: 1u76 A:127-255 [113078]
    complexed with a target peptide

Details for d1u76a2

PDB Entry: 1u76 (more details), 2.6 Å

PDB Description: Crystal structure of hPCNA bound to residues 452-466 of the DNA polymerase-delta-p66 subunit
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1u76a2:

Sequence, based on SEQRES records: (download)

>d1u76a2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records): (download)

>d1u76a2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
eeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyy
lapki

SCOPe Domain Coordinates for d1u76a2:

Click to download the PDB-style file with coordinates for d1u76a2.
(The format of our PDB-style files is described here.)

Timeline for d1u76a2: