Lineage for d1u76a2 (1u76 A:127-255)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733777Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 733778Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 733819Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 733841Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 733882Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
  8. 733898Domain d1u76a2: 1u76 A:127-255 [113078]

Details for d1u76a2

PDB Entry: 1u76 (more details), 2.6 Å

PDB Description: Crystal structure of hPCNA bound to residues 452-466 of the DNA polymerase-delta-p66 subunit
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d1u76a2:

Sequence, based on SEQRES records: (download)

>d1u76a2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records): (download)

>d1u76a2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
eeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyy
lapki

SCOP Domain Coordinates for d1u76a2:

Click to download the PDB-style file with coordinates for d1u76a2.
(The format of our PDB-style files is described here.)

Timeline for d1u76a2: