SCOPe 2.08: Domain d1u73b_: 1u73 B:

Lineage for d1u73b_ (1u73 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (9 PDB entries)
   Uniprot Q8AXY1 17-138

8. Domain d1u73b_: 1u73 B: [113076]

Details for d1u73b_

PDB Entry: 1u73, 1.9 Å

PDB Description: Crystal structure of a Dimeric Acidic Platelet Aggregation Inhibitor and Hypotensive Phospholipase A2 from Bothrops jararacussu

PDB Compounds: (B:) hypotensive phospholipase A2

SCOPe Domain Sequences for d1u73b_:

Sequence; same for both SEQRES and ATOM records:

>d1u73b_ a.133.1.2 (B:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc

Timeline for d1u73b_:

• d1u73b_ first appeared in SCOP 1.71
  
• d1u73b_ appears in SCOPe 2.07