Lineage for d1u73a_ (1u73 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733155Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (9 PDB entries)
    Uniprot Q8AXY1 17-138
  8. 2733161Domain d1u73a_: 1u73 A: [113075]

Details for d1u73a_

PDB Entry: 1u73 (more details), 1.9 Å

PDB Description: Crystal structure of a Dimeric Acidic Platelet Aggregation Inhibitor and Hypotensive Phospholipase A2 from Bothrops jararacussu
PDB Compounds: (A:) hypotensive phospholipase A2

SCOPe Domain Sequences for d1u73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u73a_ a.133.1.2 (A:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc

SCOPe Domain Coordinates for d1u73a_:

Click to download the PDB-style file with coordinates for d1u73a_.
(The format of our PDB-style files is described here.)

Timeline for d1u73a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u73b_