Lineage for d1u6md_ (1u6m D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731269Protein Putative acetyltransferase EF0945 [118070] (1 species)
  7. 731270Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry)
  8. 731274Domain d1u6md_: 1u6m D: [113072]
    Structural genomics target
    complexed with so4

Details for d1u6md_

PDB Entry: 1u6m (more details), 2.4 Å

PDB Description: the crystal structure of acetyltransferase
PDB Compounds: (D:) acetyltransferase, GNAT family

SCOP Domain Sequences for d1u6md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6md_ d.108.1.1 (D:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}
slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
ynhmqkeve

SCOP Domain Coordinates for d1u6md_:

Click to download the PDB-style file with coordinates for d1u6md_.
(The format of our PDB-style files is described here.)

Timeline for d1u6md_: