Lineage for d1u6mc_ (1u6m C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921554Protein Putative acetyltransferase EF0945 [118070] (1 species)
  7. 1921555Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry)
    Uniprot Q836Z8
  8. 1921558Domain d1u6mc_: 1u6m C: [113071]
    Structural genomics target
    complexed with so4

Details for d1u6mc_

PDB Entry: 1u6m (more details), 2.4 Å

PDB Description: the crystal structure of acetyltransferase
PDB Compounds: (C:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d1u6mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6mc_ d.108.1.1 (C:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}
slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
ynhmqkeve

SCOPe Domain Coordinates for d1u6mc_:

Click to download the PDB-style file with coordinates for d1u6mc_.
(The format of our PDB-style files is described here.)

Timeline for d1u6mc_: