SCOPe 2.04: Domain d1u6mb_: 1u6m B:

Lineage for d1u6mb_ (1u6m B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Putative acetyltransferase EF0945 [118070] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry)
   Uniprot Q836Z8

8. Domain d1u6mb_: 1u6m B: [113070]
   Structural genomics target
   complexed with so4

Details for d1u6mb_

PDB Entry: 1u6m, 2.4 Å

PDB Description: the crystal structure of acetyltransferase

PDB Compounds: (B:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d1u6mb_:

Sequence; same for both SEQRES and ATOM records:

>d1u6mb_ d.108.1.1 (B:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}
slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
ynhmqkeve

Timeline for d1u6mb_:

• d1u6mb_ first appeared in SCOP 1.71
  
• d1u6mb_ appears in SCOPe 2.03
  
• d1u6mb_ appears in SCOPe 2.05
  
• d1u6mb_ appears in the current release, SCOPe 2.08, called d1u6mb1