Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins) Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping) |
Protein Hypothetical protein PA1353 [117874] (1 species) Family assignment by BLAST; HMM assignment is the Glyoxalase family (Pfam PF00903) |
Species Pseudomonas aeruginosa [TaxId:287] [117875] (1 PDB entry) Uniprot Q9I3Z1 |
Domain d1u6lb1: 1u6l B:4-138 [113068] Other proteins in same PDB: d1u6la2, d1u6lb2 Structural genomics target |
PDB Entry: 1u6l (more details), 2.81 Å
SCOPe Domain Sequences for d1u6lb1:
Sequence, based on SEQRES records: (download)
>d1u6lb1 d.32.1.7 (B:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} qivpylifngncreafscyhqhlggtleamlpfgdspecgdipadwkdkimharlvvgsf almasdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmf tdrfgvawmvnceqd
>d1u6lb1 d.32.1.7 (B:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} qivpylifngncreafscyhqhlggtleamlpfgdspepadwkdkimharlvvgsfalma sdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmftdrf gvawmvnceqd
Timeline for d1u6lb1: