SCOPe 2.08: Domain d1u6lb1: 1u6l B:4-138

Lineage for d1u6lb1 (1u6l B:4-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
   Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)

6. Protein Hypothetical protein PA1353 [117874] (1 species)
   Family assignment by BLAST; HMM assignment is the Glyoxalase family (Pfam PF00903)

7. Species Pseudomonas aeruginosa [TaxId:287] [117875] (1 PDB entry)
   Uniprot Q9I3Z1

8. Domain d1u6lb1: 1u6l B:4-138 [113068]
   Other proteins in same PDB: d1u6la2, d1u6lb2
   Structural genomics target

Details for d1u6lb1

PDB Entry: 1u6l, 2.81 Å

PDB Description: crystal structure of protein pa1353 from pseudomonas aeruginosa

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1u6lb1:

Sequence, based on SEQRES records:

>d1u6lb1 d.32.1.7 (B:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}
qivpylifngncreafscyhqhlggtleamlpfgdspecgdipadwkdkimharlvvgsf
almasdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmf
tdrfgvawmvnceqd

Sequence, based on observed residues (ATOM records):

>d1u6lb1 d.32.1.7 (B:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}
qivpylifngncreafscyhqhlggtleamlpfgdspepadwkdkimharlvvgsfalma
sdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmftdrf
gvawmvnceqd

Timeline for d1u6lb1:

• d1u6lb1 first appeared in SCOP 1.71, called d1u6lb_
  
• d1u6lb1 appears in SCOPe 2.07