Lineage for d1u6la1 (1u6l A:4-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942843Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
    Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)
  6. 2942847Protein Hypothetical protein PA1353 [117874] (1 species)
    Family assignment by BLAST; HMM assignment is the Glyoxalase family (Pfam PF00903)
  7. 2942848Species Pseudomonas aeruginosa [TaxId:287] [117875] (1 PDB entry)
    Uniprot Q9I3Z1
  8. 2942849Domain d1u6la1: 1u6l A:4-138 [113067]
    Other proteins in same PDB: d1u6la2, d1u6lb2
    Structural genomics target

Details for d1u6la1

PDB Entry: 1u6l (more details), 2.81 Å

PDB Description: crystal structure of protein pa1353 from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1u6la1:

Sequence, based on SEQRES records: (download)

>d1u6la1 d.32.1.7 (A:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}
qivpylifngncreafscyhqhlggtleamlpfgdspecgdipadwkdkimharlvvgsf
almasdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmf
tdrfgvawmvnceqd

Sequence, based on observed residues (ATOM records): (download)

>d1u6la1 d.32.1.7 (A:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}
qivpylifngncreafscyhqhlggtleamlpfgdspepadwkdkimharlvvgsfalma
sdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmftdrf
gvawmvnceqd

SCOPe Domain Coordinates for d1u6la1:

Click to download the PDB-style file with coordinates for d1u6la1.
(The format of our PDB-style files is described here.)

Timeline for d1u6la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6la2