Lineage for d1u6gc_ (1u6g C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 646904Family a.118.1.2: HEAT repeat [48385] (2 proteins)
    Pfam PF02985
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 646919Protein Cullin-associated NEDD8-dissociated protein 1 (Tip120) [117000] (1 species)
  7. 646920Species Human (Homo sapiens) [TaxId:9606] [117001] (1 PDB entry)
  8. 646921Domain d1u6gc_: 1u6g C: [113066]
    Other proteins in same PDB: d1u6ga1, d1u6ga2, d1u6ga3, d1u6gb_
    complexed with zn

Details for d1u6gc_

PDB Entry: 1u6g (more details), 3.1 Å

PDB Description: Crystal Structure of The Cand1-Cul1-Roc1 Complex
PDB Compounds: (C:) TIP120 protein

SCOP Domain Sequences for d1u6gc_:

Sequence, based on SEQRES records: (download)

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}
asyhisnllekmtssdkdfrfmatndlmtelqkdsikldddserkvvkmilklledknge
vqnlavkclgplvskvkeyqvetivdtlctnmlsdkeqlrdissiglktvigelppassg
salaanvckkitgrltsaiakqedvsvqlealdimadmlsrqggllvnfhpsiltcllpq
ltsprlavrkrtiialghlvmscgnivfvdliehllselskndsmsttrtyiqciaaisr
qaghrigeylekiiplvvkfcnvdddelreyciqafesfvrrcpkevyphvstiiniclk
yltydpnynyddededenamdadggddddqgsddeysddddmswkvrraaakcldavvst
rhemlpefyktvspalisrfkereenvkadvfhaylsllkqtrpvqswlcdpdameqget
pltmlqsqvpnivkalhkqmkeksvktrqccfnmltelvnvlpgaltqhipvlvpgiifs
lndkssssnlkidalsclyvilcnhspqvfhphvqalvppvvacvgdpfykitseallvt
qqlvkvirpldqpssfdatpyikdlftctikrlkaadidqevkeraiscmgqiicnlgdn
lgsdlpntlqiflerlkneitrlttvkaltliagsplkidlrpvlgegvpilasflrknq
ralklgtlsaldiliknysdsltaamidavldelpplisesdmhvsqmaisflttlakvy
psslskisgsilneliglvrspllqggalsamldffqalvvtgtnnlgymdllrmltgpv
ysqstalthkqsyysiakcvaaltracpkegpavvgqfiqdvknsrstdsirllallslg
evghhidlsgqlelksvileafsspseevksaasyalgsisvgnlpeylpfvlqeitsqp
krqylllhslkeiissasvvglkpyveniwalllkhcecaeegtrnvvaeclgkltlidp
etllprlkgylisgssyarssvvtavkftisdhpqpidpllkncigdflktledpdlnvr
rvalvtfnsaahnkpslirdlldtvlphlynetkvrkelirevemgpfkhtvddgldirk
aafecmytlldscldrldifeflnhvedglkdhydikmltflmlvrlstlcpsavlqrld
rlveplratcttkvkansvkqefekqdelkrsamravaalltipeaeksplmsefqsqis
snpelaa

Sequence, based on observed residues (ATOM records): (download)

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}
asyhisnllekmtssdkdfrfmatndlmtelqkdsikldddserkvvkmilklledknge
vqnlavkclgplvskvkeyqvetivdtlctnmlsdkeqlrdissiglktvigelpsalaa
nvckkitgrltsaiakqedvsvqlealdimadmlsrqggllvnfhpsiltcllpqltspr
lavrkrtiialghlvmscfvdliehllselskndsmsttrtyiqciaaisrqaghrigey
lekiiplvvkfcnvdddelreyciqafesfvrrcpkevyphvstiiniclkyltydmswk
vrraaakcldavvstrhemlpefyktvspalisrfkereenvkadvfhaylsllkqtrpv
getpltmlqsqvpnivkalhkqmkeksvktrqccfnmltelvnvlpgaltqhipvlvpgi
ifslndkssssnlkidalsclyvilcnhspqvfhphvqalvppvvacvgdpfykitseal
lvtqqlvkvirpldqpssfdatpyikdlftctikrlkaadidqevkeraiscmgqiicnl
gdnlgsdlpntlqiflerlkneitrlttvkaltliagsplkidlrpvlgegvpilasflr
knqralklgtlsaldiliknysdsltaamidavldelpplisesdmhvsqmaisflttla
kvypsslskisgsilneliglvrspllqggalsamldffqalvvtgtnnlgymdllrmlt
gpvysqthkqsyysiakcvaaltracpkegpavvgqfiqdvknsrstdsirllallslge
vghhidlsgqlelksvileafsspseevksaasyalgsisvgnlpeylpfvlqeitsqpk
rqylllhslkeiissasvvglkpyveniwalllkhcecaeegtrnvvaeclgkltlidpe
tllprlkgylisgssyarssvvtavkftisdhpqpidpllkncigdflktledpdlnvrr
valvtfnsaahnkpslirdlldtvlphlynetkvrkelirevemgpfkhtvddgldirka
afecmytlldscldrldifeflnhvedglkdhydikmltflmlvrlstlcpsavlqrldr
lveplratcttkvkansvkqefekqdelkrsamravaalltipeaeksplmsefqsqiss
npelaa

SCOP Domain Coordinates for d1u6gc_:

Click to download the PDB-style file with coordinates for d1u6gc_.
(The format of our PDB-style files is described here.)

Timeline for d1u6gc_: