Lineage for d1u6gc_ (1u6g C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006480Family a.118.1.2: HEAT repeat [48385] (2 protein domains)
    Pfam PF02985
  6. 2006509Protein Cullin-associated NEDD8-dissociated protein 1 (Tip120) [117000] (1 species)
  7. 2006510Species Human (Homo sapiens) [TaxId:9606] [117001] (1 PDB entry)
    Uniprot Q86VP6 4-1210
  8. 2006511Domain d1u6gc_: 1u6g C: [113066]
    Other proteins in same PDB: d1u6ga1, d1u6ga2, d1u6ga3, d1u6gb_
    complexed with zn

Details for d1u6gc_

PDB Entry: 1u6g (more details), 3.1 Å

PDB Description: Crystal Structure of The Cand1-Cul1-Roc1 Complex
PDB Compounds: (C:) TIP120 protein

SCOPe Domain Sequences for d1u6gc_:

Sequence, based on SEQRES records: (download)

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}
asyhisnllekmtssdkdfrfmatndlmtelqkdsikldddserkvvkmilklledknge
vqnlavkclgplvskvkeyqvetivdtlctnmlsdkeqlrdissiglktvigelppassg
salaanvckkitgrltsaiakqedvsvqlealdimadmlsrqggllvnfhpsiltcllpq
ltsprlavrkrtiialghlvmscgnivfvdliehllselskndsmsttrtyiqciaaisr
qaghrigeylekiiplvvkfcnvdddelreyciqafesfvrrcpkevyphvstiiniclk
yltydpnynyddededenamdadggddddqgsddeysddddmswkvrraaakcldavvst
rhemlpefyktvspalisrfkereenvkadvfhaylsllkqtrpvqswlcdpdameqget
pltmlqsqvpnivkalhkqmkeksvktrqccfnmltelvnvlpgaltqhipvlvpgiifs
lndkssssnlkidalsclyvilcnhspqvfhphvqalvppvvacvgdpfykitseallvt
qqlvkvirpldqpssfdatpyikdlftctikrlkaadidqevkeraiscmgqiicnlgdn
lgsdlpntlqiflerlkneitrlttvkaltliagsplkidlrpvlgegvpilasflrknq
ralklgtlsaldiliknysdsltaamidavldelpplisesdmhvsqmaisflttlakvy
psslskisgsilneliglvrspllqggalsamldffqalvvtgtnnlgymdllrmltgpv
ysqstalthkqsyysiakcvaaltracpkegpavvgqfiqdvknsrstdsirllallslg
evghhidlsgqlelksvileafsspseevksaasyalgsisvgnlpeylpfvlqeitsqp
krqylllhslkeiissasvvglkpyveniwalllkhcecaeegtrnvvaeclgkltlidp
etllprlkgylisgssyarssvvtavkftisdhpqpidpllkncigdflktledpdlnvr
rvalvtfnsaahnkpslirdlldtvlphlynetkvrkelirevemgpfkhtvddgldirk
aafecmytlldscldrldifeflnhvedglkdhydikmltflmlvrlstlcpsavlqrld
rlveplratcttkvkansvkqefekqdelkrsamravaalltipeaeksplmsefqsqis
snpelaa

Sequence, based on observed residues (ATOM records): (download)

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}
asyhisnllekmtssdkdfrfmatndlmtelqkdsikldddserkvvkmilklledknge
vqnlavkclgplvskvkeyqvetivdtlctnmlsdkeqlrdissiglktvigelpsalaa
nvckkitgrltsaiakqedvsvqlealdimadmlsrqggllvnfhpsiltcllpqltspr
lavrkrtiialghlvmscfvdliehllselskndsmsttrtyiqciaaisrqaghrigey
lekiiplvvkfcnvdddelreyciqafesfvrrcpkevyphvstiiniclkyltydmswk
vrraaakcldavvstrhemlpefyktvspalisrfkereenvkadvfhaylsllkqtrpv
getpltmlqsqvpnivkalhkqmkeksvktrqccfnmltelvnvlpgaltqhipvlvpgi
ifslndkssssnlkidalsclyvilcnhspqvfhphvqalvppvvacvgdpfykitseal
lvtqqlvkvirpldqpssfdatpyikdlftctikrlkaadidqevkeraiscmgqiicnl
gdnlgsdlpntlqiflerlkneitrlttvkaltliagsplkidlrpvlgegvpilasflr
knqralklgtlsaldiliknysdsltaamidavldelpplisesdmhvsqmaisflttla
kvypsslskisgsilneliglvrspllqggalsamldffqalvvtgtnnlgymdllrmlt
gpvysqthkqsyysiakcvaaltracpkegpavvgqfiqdvknsrstdsirllallslge
vghhidlsgqlelksvileafsspseevksaasyalgsisvgnlpeylpfvlqeitsqpk
rqylllhslkeiissasvvglkpyveniwalllkhcecaeegtrnvvaeclgkltlidpe
tllprlkgylisgssyarssvvtavkftisdhpqpidpllkncigdflktledpdlnvrr
valvtfnsaahnkpslirdlldtvlphlynetkvrkelirevemgpfkhtvddgldirka
afecmytlldscldrldifeflnhvedglkdhydikmltflmlvrlstlcpsavlqrldr
lveplratcttkvkansvkqefekqdelkrsamravaalltipeaeksplmsefqsqiss
npelaa

SCOPe Domain Coordinates for d1u6gc_:

Click to download the PDB-style file with coordinates for d1u6gc_.
(The format of our PDB-style files is described here.)

Timeline for d1u6gc_: