Lineage for d1u6ga3 (1u6g A:411-686)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574524Fold e.40: Cullin homology domain [75631] (1 superfamily)
    3 domains: (1) 4-helical bundle; (2) alpha+beta; (3) "winged helix"-like
  4. 2574525Superfamily e.40.1: Cullin homology domain [75632] (1 family) (S)
  5. 2574526Family e.40.1.1: Cullin homology domain [75633] (2 proteins)
  6. 2574527Protein Cullin homolog 1, cul-1 [75634] (1 species)
  7. 2574528Species Human (Homo sapiens) [TaxId:9606] [75635] (4 PDB entries)
    Uniprot Q13616 17-776
  8. 2574530Domain d1u6ga3: 1u6g A:411-686 [113064]
    Other proteins in same PDB: d1u6ga1, d1u6ga2, d1u6gb_, d1u6gc_
    complexed with zn

Details for d1u6ga3

PDB Entry: 1u6g (more details), 3.1 Å

PDB Description: Crystal Structure of The Cand1-Cul1-Roc1 Complex
PDB Compounds: (A:) Cullin homolog 1

SCOPe Domain Sequences for d1u6ga3:

Sequence, based on SEQRES records: (download)

>d1u6ga3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]}
aqssskspellarycdsllkkssknpeeaeledtlnqvmvvfkyiedkdvfqkfyakmla
krlvhqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsepl
dldfsiqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgelv
tncfknrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllvl
edenanvdevelkpdtliklylgyknkklrvninvp

Sequence, based on observed residues (ATOM records): (download)

>d1u6ga3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]}
aqssskspellarycdsllkkeeaeledtlnqvmvvfkyiedkdvfqkfyakmlakrlvh
qnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsepldldfs
iqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgelvtncfk
nrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllvledena
nvdevelkpdtliklylgyknkklrvninvp

SCOPe Domain Coordinates for d1u6ga3:

Click to download the PDB-style file with coordinates for d1u6ga3.
(The format of our PDB-style files is described here.)

Timeline for d1u6ga3: