Lineage for d1u6ga2 (1u6g A:17-410)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007927Family a.118.17.1: Cullin repeat [74789] (2 protein domains)
  6. 2007928Protein Cullin homolog 1, Cul-1 [74790] (1 species)
  7. 2007929Species Human (Homo sapiens) [TaxId:9606] [74791] (3 PDB entries)
    Uniprot Q13616 17-776
  8. 2007931Domain d1u6ga2: 1u6g A:17-410 [113063]
    Other proteins in same PDB: d1u6ga1, d1u6ga3, d1u6gb_, d1u6gc_
    complexed with zn

Details for d1u6ga2

PDB Entry: 1u6g (more details), 3.1 Å

PDB Description: Crystal Structure of The Cand1-Cul1-Roc1 Complex
PDB Compounds: (A:) Cullin homolog 1

SCOPe Domain Sequences for d1u6ga2:

Sequence, based on SEQRES records: (download)

>d1u6ga2 a.118.17.1 (A:17-410) Cullin homolog 1, Cul-1 {Human (Homo sapiens) [TaxId: 9606]}
ldqiwddlragiqqvytrqsmaksrymelythvynyctsvhqsnqargagvppskskkgq
tpggaqfvglelykrlkeflknyltnllkdgedlmdesvlkfytqqwedyrfsskvlngi
caylnrhwvrrecdegrkgiyeiyslalvtwrdclfrplnkqvtnavlkliekerngeti
ntrlisgvvqsyvelglneddafakgptltvykesfesqfladterfytresteflqqnp
vteymkkaearlleeqrrvqvylhestqdelarkceqvliekhleifhtefqnlldadkn
edlgrmynlvsriqdglgelkkllethihnqglaaiekcgeaalndpkmyvqtvldvhkk
ynalvmsafnndagfvaaldkacgrfinnnavtkm

Sequence, based on observed residues (ATOM records): (download)

>d1u6ga2 a.118.17.1 (A:17-410) Cullin homolog 1, Cul-1 {Human (Homo sapiens) [TaxId: 9606]}
ldqiwddlragiqqvytrqsmaksrymelythvynyctsvglelykrlkeflknyltnll
kdgedlmdesvlkfytqqwedyrfsskvlngicaylnrhwvrreckgiyeiyslalvtwr
dclfrplnkqvtnavlkliekerngetintrlisgvvqsyvelglgptltvykesfesqf
ladterfytresteflqqnpvteymkkaearlleeqrrvqvylhestqdelarkceqvli
ekhleifhtefqnlldadknedlgrmynlvsriqdglgelkkllethihnqglaaiekcg
eaalndpkmyvqtvldvhkkynalvmsafnndagfvaaldkacgrfinnnavtkm

SCOPe Domain Coordinates for d1u6ga2:

Click to download the PDB-style file with coordinates for d1u6ga2.
(The format of our PDB-style files is described here.)

Timeline for d1u6ga2: