Lineage for d1u6ga1 (1u6g A:687-775)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307385Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)
  6. 2307386Protein Anaphase promoting complex (APC) [74680] (2 species)
  7. 2307392Species Human (Homo sapiens) [TaxId:9606] [74682] (4 PDB entries)
    Uniprot Q13616 17-776
  8. 2307394Domain d1u6ga1: 1u6g A:687-775 [113062]
    Other proteins in same PDB: d1u6ga2, d1u6ga3, d1u6gb_, d1u6gc_
    complexed with zn

Details for d1u6ga1

PDB Entry: 1u6g (more details), 3.1 Å

PDB Description: Crystal Structure of The Cand1-Cul1-Roc1 Complex
PDB Compounds: (A:) Cullin homolog 1

SCOPe Domain Sequences for d1u6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6ga1 a.4.5.34 (A:687-775) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]}
mkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevltqlssrfkprvp
vikkcidiliekeylervdgekdtysyla

SCOPe Domain Coordinates for d1u6ga1:

Click to download the PDB-style file with coordinates for d1u6ga1.
(The format of our PDB-style files is described here.)

Timeline for d1u6ga1: