SCOPe 2.06: Domain d1u6ga1: 1u6g A:687-775

Lineage for d1u6ga1 (1u6g A:687-775)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)

6. Protein Anaphase promoting complex (APC) [74680] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74682] (4 PDB entries)
   Uniprot Q13616 17-776

8. Domain d1u6ga1: 1u6g A:687-775 [113062]
   Other proteins in same PDB: d1u6ga2, d1u6ga3, d1u6gb_, d1u6gc_
   complexed with zn

Details for d1u6ga1

PDB Entry: 1u6g, 3.1 Å

PDB Description: Crystal Structure of The Cand1-Cul1-Roc1 Complex

PDB Compounds: (A:) Cullin homolog 1

SCOPe Domain Sequences for d1u6ga1:

Sequence; same for both SEQRES and ATOM records:

>d1u6ga1 a.4.5.34 (A:687-775) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]}
mkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevltqlssrfkprvp
vikkcidiliekeylervdgekdtysyla

Timeline for d1u6ga1:

• d1u6ga1 first appeared in SCOP 1.71
  
• d1u6ga1 appears in SCOPe 2.05
  
• d1u6ga1 appears in SCOPe 2.07
  
• d1u6ga1 appears in the current release, SCOPe 2.08