Lineage for d1u6dx_ (1u6d X:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565371Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 565650Superfamily b.68.11: Kelch motif [117281] (1 family) (S)
  5. 565651Family b.68.11.1: Kelch motif [117282] (1 protein)
    Pfam 01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (scop_pr 50967)
  6. 565652Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (1 species)
  7. 565653Species Human (Homo sapiens) [TaxId:9606] [117284] (1 PDB entry)
  8. 565654Domain d1u6dx_: 1u6d X: [113061]

Details for d1u6dx_

PDB Entry: 1u6d (more details), 1.85 Å

PDB Description: Crystal structure of the Kelch domain of human Keap1

SCOP Domain Sequences for d1u6dx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6dx_ b.68.11.1 (X:) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens)}
pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOP Domain Coordinates for d1u6dx_:

Click to download the PDB-style file with coordinates for d1u6dx_.
(The format of our PDB-style files is described here.)

Timeline for d1u6dx_: