Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.96: T-fold [55619] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins) beta-sheets of four subunits form a barrel, closed: n=16, S=16 |
Protein 7,8-dihydroneopterin aldolase [55629] (3 species) |
Species Staphylococcus aureus [TaxId:1280] [55630] (10 PDB entries) |
Domain d1u68a_: 1u68 A: [113060] complexed with npr |
PDB Entry: 1u68 (more details), 2.4 Å
SCOP Domain Sequences for d1u68a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u68a_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Staphylococcus aureus} mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren k
Timeline for d1u68a_: