Lineage for d1u68a_ (1u68 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608476Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 608477Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 608636Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
  6. 608637Protein 7,8-dihydroneopterin aldolase [55629] (3 species)
  7. 608648Species Staphylococcus aureus [TaxId:1280] [55630] (10 PDB entries)
  8. 608657Domain d1u68a_: 1u68 A: [113060]
    complexed with npr

Details for d1u68a_

PDB Entry: 1u68 (more details), 2.4 Å

PDB Description: dhna 7,8 dihydroneopterin complex

SCOP Domain Sequences for d1u68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u68a_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Staphylococcus aureus}
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k

SCOP Domain Coordinates for d1u68a_:

Click to download the PDB-style file with coordinates for d1u68a_.
(The format of our PDB-style files is described here.)

Timeline for d1u68a_: