Lineage for d1u5xa_ (1u5x A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555454Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 555455Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 555456Family b.22.1.1: TNF-like [49843] (12 proteins)
  6. 555468Protein A proliferation-inducing ligand, APRIL [117117] (1 species)
  7. 555469Species Mouse (Mus musculus) [TaxId:10090] [117118] (5 PDB entries)
  8. 555473Domain d1u5xa_: 1u5x A: [113055]

Details for d1u5xa_

PDB Entry: 1u5x (more details), 1.8 Å

PDB Description: Crystal structure of murine APRIL at pH 5.0

SCOP Domain Sequences for d1u5xa_:

Sequence, based on SEQRES records: (download)

>d1u5xa_ b.22.1.1 (A:) A proliferation-inducing ligand, APRIL {Mouse (Mus musculus)}
khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
aklslsphgtflgfvkl

Sequence, based on observed residues (ATOM records): (download)

>d1u5xa_ b.22.1.1 (A:) A proliferation-inducing ligand, APRIL {Mouse (Mus musculus)}
khsvlhlvpvnitsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhdvtft
mgqvvsregqgrretlfrcirsmpsdaynscysagvfhlhqgdiitvkipranaklslsp
hgtflgfvkl

SCOP Domain Coordinates for d1u5xa_:

Click to download the PDB-style file with coordinates for d1u5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1u5xa_: