SCOP 1.71: Domain d1u5rb_: 1u5r B:

Lineage for d1u5rb_ (1u5r B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Serine/threonine protein kinase TAO2 [118127] (1 species)
   OPK group; serine/threonine kinase

7. Species Rat (Rattus norvegicus) [TaxId:10116] [118128] (2 PDB entries)

8. Domain d1u5rb_: 1u5r B: [113051]
   complexed with atp, ca, mg

Details for d1u5rb_

PDB Entry: 1u5r, 2.1 Å

PDB Description: Crystal Structure of the TAO2 Kinase Domain: Activation and Specifity of a Ste20p MAP3K

SCOP Domain Sequences for d1u5rb_:

Sequence; same for both SEQRES and ATOM records:

>d1u5rb_ d.144.1.7 (B:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus)}
dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
mkkilfqea

Timeline for d1u5rb_:

• d1u5rb_ is new in SCOP 1.71
  
• d1u5rb_ appears in SCOP 1.73
  
• d1u5rb_ appears in the current release, SCOPe 2.08