Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Serine/threonine protein kinase TAO2 [118127] (1 species) OPK group; serine/threonine kinase |
Species Rat (Rattus norvegicus) [TaxId:10116] [118128] (2 PDB entries) |
Domain d1u5rb_: 1u5r B: [113051] complexed with atp, ca, mg |
PDB Entry: 1u5r (more details), 2.1 Å
SCOP Domain Sequences for d1u5rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5rb_ d.144.1.7 (B:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus)} dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk mkkilfqea
Timeline for d1u5rb_: