| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Serine/threonine protein kinase TAO2 [118127] (1 species) OPK group; serine/threonine kinase |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [118128] (3 PDB entries) Uniprot Q9JLS3 12-320 |
| Domain d1u5ra_: 1u5r A: [113050] complexed with atp, ca, mg |
PDB Entry: 1u5r (more details), 2.1 Å
SCOPe Domain Sequences for d1u5ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
mkkilfqea
Timeline for d1u5ra_: