Class a: All alpha proteins [46456] (286 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (2 families) |
Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
Protein Spectrin alpha chain [46968] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries) Uniprot P07751 1662-1981 |
Domain d1u5pa2: 1u5p A:1772-1872 [113047] repeats 15 and 16 complexed with k, po4 |
PDB Entry: 1u5p (more details), 2 Å
SCOPe Domain Sequences for d1u5pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrle
Timeline for d1u5pa2: