SCOPe 2.05: Domain d1u5pa2: 1u5p A:1772-1872

Lineage for d1u5pa2 (1u5p A:1772-1872)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (2 families)

5. Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin alpha chain [46968] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
   Uniprot P07751 1662-1981

8. Domain d1u5pa2: 1u5p A:1772-1872 [113047]
   repeats 15 and 16
   complexed with k, po4

Details for d1u5pa2

PDB Entry: 1u5p, 2 Å

PDB Description: Crystal Structure of Repeats 15 and 16 of Chicken Brain Alpha Spectrin

PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d1u5pa2:

Sequence; same for both SEQRES and ATOM records:

>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrle

Timeline for d1u5pa2:

• d1u5pa2 first appeared in SCOP 1.71
  
• d1u5pa2 appears in SCOPe 2.04
  
• d1u5pa2 appears in SCOPe 2.06
  
• d1u5pa2 appears in the current release, SCOPe 2.08