Lineage for d1u5pa1 (1u5p A:1662-1771)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985819Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 1985820Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 1985833Protein Spectrin alpha chain [46968] (3 species)
  7. 1985834Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
    Uniprot P07751 1662-1981
  8. 1985835Domain d1u5pa1: 1u5p A:1662-1771 [113046]
    repeats 15 and 16
    complexed with k, po4

Details for d1u5pa1

PDB Entry: 1u5p (more details), 2 Å

PDB Description: Crystal Structure of Repeats 15 and 16 of Chicken Brain Alpha Spectrin
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d1u5pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
ankqqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlkd
lnsqadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrl

SCOPe Domain Coordinates for d1u5pa1:

Click to download the PDB-style file with coordinates for d1u5pa1.
(The format of our PDB-style files is described here.)

Timeline for d1u5pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5pa2