SCOP 1.73: Domain d1u5pa1: 1u5p A:1662-1771

Lineage for d1u5pa1 (1u5p A:1662-1771)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (1 family)

5. Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin alpha chain [46968] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)

8. Domain d1u5pa1: 1u5p A:1662-1771 [113046]

Details for d1u5pa1

PDB Entry: 1u5p, 2 Å

PDB Description: Crystal Structure of Repeats 15 and 16 of Chicken Brain Alpha Spectrin

PDB Compounds: (A:) Spectrin alpha chain, brain

SCOP Domain Sequences for d1u5pa1:

Sequence; same for both SEQRES and ATOM records:

>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
ankqqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlkd
lnsqadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrl

Timeline for d1u5pa1:

• d1u5pa1 first appeared in SCOP 1.71
  
• d1u5pa1 appears in SCOP 1.75
  
• d1u5pa1 appears in the current release, SCOPe 2.08