Lineage for d1u5ma1 (1u5m A:5-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034865Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 3034866Superfamily g.27.1: FnI-like domain [57603] (3 families) (S)
  5. 3034920Family g.27.1.2: VWC domain [118264] (1 protein)
    Pfam PF00093; similar to FnI domain in the N-terminal part, contains extra C-terminal subdomain
  6. 3034921Protein Collagen alpha 1(II) chain precursor [118265] (1 species)
  7. 3034922Species Human (Homo sapiens) [TaxId:9606] [118266] (1 PDB entry)
    Uniprot P02458 29-97
  8. 3034923Domain d1u5ma1: 1u5m A:5-73 [113043]
    Other proteins in same PDB: d1u5ma2
    splice isoform 2

Details for d1u5ma1

PDB Entry: 1u5m (more details)

PDB Description: structure of a chordin-like cysteine-rich repeat (vwc module) from collagen iia
PDB Compounds: (A:) alpha 1 type II collagen isoform 1

SCOPe Domain Sequences for d1u5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ma1 g.27.1.2 (A:5-73) Collagen alpha 1(II) chain precursor {Human (Homo sapiens) [TaxId: 9606]}
qeagscvqdgqryndkdvwkpepcricvcdtgtvlcddiicedvkdclspeipfgeccpi
cpadlaaaa

SCOPe Domain Coordinates for d1u5ma1:

Click to download the PDB-style file with coordinates for d1u5ma1.
(The format of our PDB-style files is described here.)

Timeline for d1u5ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5ma2