Lineage for d1u5la1 (1u5l A:121-225)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175107Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2175108Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2175109Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2175110Protein Prion protein domain [54100] (14 species)
  7. 2175159Species Red-eared slider turtle (Trachemys scripta) [TaxId:34903] [117767] (1 PDB entry)
    Uniprot Q9I9C0 141-248
  8. 2175160Domain d1u5la1: 1u5l A:121-225 [113042]
    Other proteins in same PDB: d1u5la2

Details for d1u5la1

PDB Entry: 1u5l (more details)

PDB Description: solution structure of the turtle prion protein fragment (121-226)
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1u5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5la1 d.6.1.1 (A:121-225) Prion protein domain {Red-eared slider turtle (Trachemys scripta) [TaxId: 34903]}
vvgglggyalgsamsgmrmnfdrpeerqwwnensnrypnqvyykeyndrsvpegrfvrdc
vnitvteykidpnenqnvtqvevrvmkqviqemcmqqyqqyqlas

SCOPe Domain Coordinates for d1u5la1:

Click to download the PDB-style file with coordinates for d1u5la1.
(The format of our PDB-style files is described here.)

Timeline for d1u5la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5la2