Lineage for d1u5ka2 (1u5k A:81-237)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625139Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 625140Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (2 families) (S)
  5. 625145Family g.45.1.2: RecO C-terminal domain-like [118303] (1 protein)
    C-terminal part of Pfam 02565
  6. 625146Protein Recombinational repair protein RecO, C-terminal domain [118304] (1 species)
  7. 625147Species Deinococcus radiodurans [TaxId:1299] [118305] (1 PDB entry)
  8. 625148Domain d1u5ka2: 1u5k A:81-237 [113039]
    Other proteins in same PDB: d1u5ka1, d1u5kb1

Details for d1u5ka2

PDB Entry: 1u5k (more details), 2 Å

PDB Description: Recombinational repair protein RecO

SCOP Domain Sequences for d1u5ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans}
ptlaeperyafahlmaefadalfqegefseqafdlfaaslrgvahqpdpewvalvmsykl
lglagvipqtarcarcgapdpehpdplggqllcskcaalppyppavldflrhavrrtvra
sfeqpvpsadrpalwralekfvtvqvggvhswrqlvp

SCOP Domain Coordinates for d1u5ka2:

Click to download the PDB-style file with coordinates for d1u5ka2.
(The format of our PDB-style files is described here.)

Timeline for d1u5ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5ka1