Lineage for d1u5ka1 (1u5k A:2-80)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383789Family b.40.4.13: RecO N-terminal domain-like [117204] (1 protein)
    N-terminal part of Pfam PF02565
  6. 2383790Protein Recombinational repair protein RecO, N-terminal domain [117205] (1 species)
  7. 2383791Species Deinococcus radiodurans [TaxId:1299] [117206] (2 PDB entries)
    Uniprot Q9RW50 # DR0819
  8. 2383792Domain d1u5ka1: 1u5k A:2-80 [113038]
    Other proteins in same PDB: d1u5ka2, d1u5kb2
    complexed with zn

Details for d1u5ka1

PDB Entry: 1u5k (more details), 2 Å

PDB Description: Recombinational repair protein RecO
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1u5ka1:

Sequence, based on SEQRES records: (download)

>d1u5ka1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
rsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqvy
qgphndlasvkqavlegal

Sequence, based on observed residues (ATOM records): (download)

>d1u5ka1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
rsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqvy
qgphdlasvkqavlegal

SCOPe Domain Coordinates for d1u5ka1:

Click to download the PDB-style file with coordinates for d1u5ka1.
(The format of our PDB-style files is described here.)

Timeline for d1u5ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5ka2