![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52928] (14 PDB entries) |
![]() | Domain d1u5bb2: 1u5b B:205-342 [113036] Other proteins in same PDB: d1u5ba_, d1u5bb1 complexed with gol, k, mn, tdp |
PDB Entry: 1u5b (more details), 1.83 Å
SCOP Domain Sequences for d1u5bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5bb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)} pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf yipdkwkcydalrkminy
Timeline for d1u5bb2: