Lineage for d1u4rd_ (1u4r D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929190Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species)
    has different dimerisation mode
  7. 2929191Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries)
    Uniprot P13501 25-91
  8. 2929212Domain d1u4rd_: 1u4r D: [113033]
    complexed with so4; mutant

Details for d1u4rd_

PDB Entry: 1u4r (more details), 2.2 Å

PDB Description: crystal structure of human rantes mutant 44-aana-47
PDB Compounds: (D:) Small inducible cytokine A5

SCOPe Domain Sequences for d1u4rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4rd_ d.9.1.1 (D:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
yinslems

SCOPe Domain Coordinates for d1u4rd_:

Click to download the PDB-style file with coordinates for d1u4rd_.
(The format of our PDB-style files is described here.)

Timeline for d1u4rd_: