Lineage for d1u4rc_ (1u4r C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716158Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 716159Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 716160Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 716335Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
    has different dimerisation mode
  7. 716336Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries)
  8. 716349Domain d1u4rc_: 1u4r C: [113032]

Details for d1u4rc_

PDB Entry: 1u4r (more details), 2.2 Å

PDB Description: crystal structure of human rantes mutant 44-aana-47
PDB Compounds: (C:) Small inducible cytokine A5

SCOP Domain Sequences for d1u4rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4rc_ d.9.1.1 (C:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
sdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvreyins
lems

SCOP Domain Coordinates for d1u4rc_:

Click to download the PDB-style file with coordinates for d1u4rc_.
(The format of our PDB-style files is described here.)

Timeline for d1u4rc_: