Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins) |
Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species) has different dimerisation mode |
Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries) |
Domain d1u4rc_: 1u4r C: [113032] |
PDB Entry: 1u4r (more details), 2.2 Å
SCOP Domain Sequences for d1u4rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u4rc_ d.9.1.1 (C:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]} sdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvreyins lems
Timeline for d1u4rc_: