Lineage for d1u4rb_ (1u4r B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852363Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 852364Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 852365Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 852544Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
    has different dimerisation mode
  7. 852545Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries)
    Uniprot P13501 25-91
  8. 852557Domain d1u4rb_: 1u4r B: [113031]

Details for d1u4rb_

PDB Entry: 1u4r (more details), 2.2 Å

PDB Description: crystal structure of human rantes mutant 44-aana-47
PDB Compounds: (B:) Small inducible cytokine A5

SCOP Domain Sequences for d1u4rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4rb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvre
yinslems

SCOP Domain Coordinates for d1u4rb_:

Click to download the PDB-style file with coordinates for d1u4rb_.
(The format of our PDB-style files is described here.)

Timeline for d1u4rb_: