SCOPe 2.05: Domain d1u4ra_: 1u4r A:

Lineage for d1u4ra_ (1u4r A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (10 PDB entries)
   Uniprot P13501 25-91

8. Domain d1u4ra_: 1u4r A: [113030]
   complexed with so4; mutant

Details for d1u4ra_

PDB Entry: 1u4r, 2.2 Å

PDB Description: crystal structure of human rantes mutant 44-aana-47

PDB Compounds: (A:) Small inducible cytokine A5

SCOPe Domain Sequences for d1u4ra_:

Sequence, based on SEQRES records:

>d1u4ra_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtaanaqvcanpekkwvreyin
slem

Sequence, based on observed residues (ATOM records):

>d1u4ra_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtnaqvcanpekkwvreyinsl
em

Timeline for d1u4ra_:

• d1u4ra_ first appeared in SCOP 1.71
  
• d1u4ra_ appears in SCOPe 2.04
  
• d1u4ra_ appears in SCOPe 2.06
  
• d1u4ra_ appears in the current release, SCOPe 2.08