Lineage for d1u4qb1 (1u4q B:1665-1771)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724372Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 1724373Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 1724386Protein Spectrin alpha chain [46968] (3 species)
  7. 1724387Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
    Uniprot P07751 1662-1981
  8. 1724399Domain d1u4qb1: 1u4q B:1665-1771 [113027]
    repeats 15, 16 and 17

Details for d1u4qb1

PDB Entry: 1u4q (more details), 2.5 Å

PDB Description: Crystal Structure of Repeats 15, 16 and 17 of Chicken Brain Alpha Spectrin
PDB Compounds: (B:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d1u4qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4qb1 a.7.1.1 (B:1665-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
qqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlkdlns
qadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrl

SCOPe Domain Coordinates for d1u4qb1:

Click to download the PDB-style file with coordinates for d1u4qb1.
(The format of our PDB-style files is described here.)

Timeline for d1u4qb1: