| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (2 families) ![]() |
| Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
| Protein Spectrin alpha chain [46968] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries) Uniprot P07751 1662-1981 |
| Domain d1u4qa1: 1u4q A:1665-1771 [113024] repeats 15, 16 and 17 |
PDB Entry: 1u4q (more details), 2.5 Å
SCOPe Domain Sequences for d1u4qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u4qa1 a.7.1.1 (A:1665-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
qqnfntgikdfdfwlseveallasedygkdlasvnnllkkhqlleadisahedrlkdlns
qadslmtssafdtsqvkdkretingrfqriksmaaarraklneshrl
Timeline for d1u4qa1: