SCOPe 2.08: Domain d1u4pb_: 1u4p B:

Lineage for d1u4pb_ (1u4p B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries)
   Uniprot P13501 25-91

8. Domain d1u4pb_: 1u4p B: [113023]
   complexed with acy; mutant

Details for d1u4pb_

PDB Entry: 1u4p, 1.7 Å

PDB Description: crystal structure of human rantes mutant k45e

PDB Compounds: (B:) Small inducible cytokine A5

SCOPe Domain Sequences for d1u4pb_:

Sequence; same for both SEQRES and ATOM records:

>d1u4pb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrenrqvcanpekkwvrey
inslem

Timeline for d1u4pb_:

• d1u4pb_ first appeared in SCOP 1.71
  
• d1u4pb_ appears in SCOPe 2.07