Lineage for d1u4pa_ (1u4p A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597802Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 597803Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 597804Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 597971Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
    has different dimerisation mode
  7. 597972Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries)
  8. 597977Domain d1u4pa_: 1u4p A: [113022]

Details for d1u4pa_

PDB Entry: 1u4p (more details), 1.7 Å

PDB Description: crystal structure of human rantes mutant k45e

SCOP Domain Sequences for d1u4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4pa_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrenrqvcanpekkwvre
yinslem

SCOP Domain Coordinates for d1u4pa_:

Click to download the PDB-style file with coordinates for d1u4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1u4pa_: