SCOPe 2.08: Domain d1u4na_: 1u4n A:

Lineage for d1u4na_ (1u4n A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Carboxylesterase [53488] (3 species)
   bacterial homologue of human hormone sensitive lipase

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [53490] (4 PDB entries)
   Uniprot Q7SIG1

8. Domain d1u4na_: 1u4n A: [113021]
   complexed with so4; mutant

Details for d1u4na_

PDB Entry: 1u4n, 2.1 Å

PDB Description: crystal structure analysis of the m211s/r215l est2 mutant

PDB Compounds: (A:) carboxylesterase est2

SCOPe Domain Sequences for d1u4na_:

Sequence; same for both SEQRES and ATOM records:

>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlkv
rmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehkfp
aavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqlli
ypstgydpahppasieenaegylltggmslwfldqylnsleelthpwfspvlypdlsglp
payiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvria
eklrdala

Timeline for d1u4na_:

• d1u4na_ first appeared in SCOP 1.71
  
• d1u4na_ appears in SCOPe 2.07