Lineage for d1u4na_ (1u4n A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900069Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 2900070Protein Carboxylesterase [53488] (3 species)
    bacterial homologue of human hormone sensitive lipase
  7. 2900071Species Alicyclobacillus acidocaldarius [TaxId:405212] [53490] (4 PDB entries)
    Uniprot Q7SIG1
  8. 2900073Domain d1u4na_: 1u4n A: [113021]
    complexed with so4; mutant

Details for d1u4na_

PDB Entry: 1u4n (more details), 2.1 Å

PDB Description: crystal structure analysis of the m211s/r215l est2 mutant
PDB Compounds: (A:) carboxylesterase est2

SCOPe Domain Sequences for d1u4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlkv
rmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehkfp
aavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqlli
ypstgydpahppasieenaegylltggmslwfldqylnsleelthpwfspvlypdlsglp
payiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvria
eklrdala

SCOPe Domain Coordinates for d1u4na_:

Click to download the PDB-style file with coordinates for d1u4na_.
(The format of our PDB-style files is described here.)

Timeline for d1u4na_: