Lineage for d1u4ma_ (1u4m A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175548Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
    has different dimerisation mode
  7. 2175549Species Human (Homo sapiens) [TaxId:9606] [54133] (14 PDB entries)
    Uniprot P13501 25-91
  8. 2175560Domain d1u4ma_: 1u4m A: [113019]
    complexed with acy, h3s

Details for d1u4ma_

PDB Entry: 1u4m (more details), 2 Å

PDB Description: human rantes complexed to heparin-derived disaccharide iii-s
PDB Compounds: (A:) Small inducible cytokine A5

SCOPe Domain Sequences for d1u4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4ma_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

SCOPe Domain Coordinates for d1u4ma_:

Click to download the PDB-style file with coordinates for d1u4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1u4ma_: