Lineage for d1u4la_ (1u4l A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species)
    has different dimerisation mode
  7. Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries)
    Uniprot P13501 25-91
  8. Domain d1u4la_: 1u4l A: [113017]
    complexed with acy

Details for d1u4la_

PDB Entry: 1u4l (more details), 2 Å

PDB Description: human rantes complexed to heparin-derived disaccharide i-s
PDB Compounds: (A:) Small inducible cytokine A5

SCOPe Domain Sequences for d1u4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4la_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

SCOPe Domain Coordinates for d1u4la_ are not available.

Timeline for d1u4la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u4lb_