SCOPe 2.08: Domain d1u4la_: 1u4l A:

Lineage for d1u4la_ (1u4l A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries)
   Uniprot P13501 25-91

8. Domain d1u4la_: 1u4l A: [113017]
   complexed with acy

Details for d1u4la_

PDB Entry: 1u4l, 2 Å

PDB Description: human rantes complexed to heparin-derived disaccharide i-s

PDB Compounds: (A:) Small inducible cytokine A5

SCOPe Domain Sequences for d1u4la_:

Sequence; same for both SEQRES and ATOM records:

>d1u4la_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

Timeline for d1u4la_:

• d1u4la_ first appeared in SCOP 1.71
  
• d1u4la_ appears in SCOPe 2.07