Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins) N-terminal all-beta domain defines family |
Protein Alcohol dehydrogenase [51737] (9 species) |
Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries) Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327 |
Domain d1u3wa2: 1u3w A:163-338 [113014] Other proteins in same PDB: d1u3wa1, d1u3wb1 complexed with fxy, nad, zn |
PDB Entry: 1u3w (more details), 1.45 Å
SCOPe Domain Sequences for d1u3wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3wa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} asplekvcligcgfstgygsavkvakvtpgstcavfglggvglsvvmgckaagaariiav dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigqldtmmasllcc heacgtsvivgvppdsqnlsinpmllltgrtwkgaifggfkskesvpklvadfmak
Timeline for d1u3wa2: