SCOP 1.71: Domain d1u3wa2: 1u3w A:163-338

Lineage for d1u3wa2 (1u3w A:163-338)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (22 PDB entries)

8. Domain d1u3wa2: 1u3w A:163-338 [113014]
   Other proteins in same PDB: d1u3wa1, d1u3wb1

Details for d1u3wa2

PDB Entry: 1u3w, 1.45 Å

PDB Description: crystal structure of human alcohol dehydrogenase gamma-2-gamma-2 isoform complexed with n-1-methylheptylformamide determined to 1.45 angstrom resolution

SCOP Domain Sequences for d1u3wa2:

Sequence; same for both SEQRES and ATOM records:

>d1u3wa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
asplekvcligcgfstgygsavkvakvtpgstcavfglggvglsvvmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigqldtmmasllcc
heacgtsvivgvppdsqnlsinpmllltgrtwkgaifggfkskesvpklvadfmak

Timeline for d1u3wa2:

• d1u3wa2 is new in SCOP 1.71
  
• d1u3wa2 appears in SCOP 1.73
  
• d1u3wa2 appears in the current release, SCOPe 2.08