Lineage for d1u3wa1 (1u3w A:1-162,A:339-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785641Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2785642Domain d1u3wa1: 1u3w A:1-162,A:339-374 [113013]
    Other proteins in same PDB: d1u3wa2, d1u3wb2
    complexed with fxy, nad, zn

Details for d1u3wa1

PDB Entry: 1u3w (more details), 1.45 Å

PDB Description: crystal structure of human alcohol dehydrogenase gamma-2-gamma-2 isoform complexed with n-1-methylheptylformamide determined to 1.45 angstrom resolution
PDB Compounds: (A:) Alcohol dehydrogenase gamma chain

SCOPe Domain Sequences for d1u3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3wa1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwelkkpfsieevevappkahevrikmvaagicrsdehvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcricknpesnyclkndlgnpr
gtlqdgtrrftcsgkpihhfvgvstfsqytvvdenavakidaXkfsldalitnvlpfeki
negfdllrsgksirtvltf

SCOPe Domain Coordinates for d1u3wa1:

Click to download the PDB-style file with coordinates for d1u3wa1.
(The format of our PDB-style files is described here.)

Timeline for d1u3wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3wa2