SCOP 1.73: Domain d1u3vb2: 1u3v B:163-338

Lineage for d1u3vb2 (1u3v B:163-338)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)

8. Domain d1u3vb2: 1u3v B:163-338 [113012]
   Other proteins in same PDB: d1u3va1, d1u3vb1
   complexed with hpl, nad, po4, zn

Details for d1u3vb2

PDB Entry: 1u3v, 1.65 Å

PDB Description: crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-heptylformamide determined to 1.65 angstrom resolution

PDB Compounds: (B:) Alcohol dehydrogenase beta chain

SCOP Domain Sequences for d1u3vb2:

Sequence; same for both SEQRES and ATOM records:

>d1u3vb2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

Timeline for d1u3vb2:

• d1u3vb2 first appeared in SCOP 1.71
  
• d1u3vb2 appears in SCOP 1.75
  
• d1u3vb2 appears in the current release, SCOPe 2.08